Bacterial taxon 223926
Locus VP_2855
Protein BAC61118.1
6-phosphofructokinase, isozyme I
Vibrio parahaemolyticus RIMD 2210633
Length 320 aa, Gene pfkA, UniProt Q87KX0
>BAC61118.1|Vibrio parahaemolyticus RIMD 2210633|6-phosphofructokinase, isozyme I
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSEGLEVFGVYDGYLGLYEGRIEKLDRSSVSDVINKGGTFLGSARFPEFKQVEVREKAIENLKKHGIDALVVIGGDGSYMGAKKLTEMGYPCIGLPGTIDNDIAGTDYTVGYLSALNTVIDAIDRLRDTSSSHQRISIVEIMGRHCGDLTLMSAIAGGCEYIITPETGLDKDKLISNIQDGIAKGKKHAIIALTELMMDANELARDIEAATGRETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLLEGHGGRCVGIVKEQLVHHDIIDAIENMKRPVRNDLYKVAEELF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.11 | 0.0016 | ●●●●○ -3.27 | -3.274523906708252 | 27185914 |
Retrieved 1 of 1 entries in 42.8 ms
(Link to these results)