Bacterial taxon 223926
Locus VP_2186
Protein BAC60449.1
bacteriocin production protein
Vibrio parahaemolyticus RIMD 2210633
Length 163 aa, Gene n/a, UniProt Q87MP5
>BAC60449.1|Vibrio parahaemolyticus RIMD 2210633|bacteriocin production protein
MNWIDFIILGVIGFSALISLVRGFAKEALSLVIWFGAFFISSNYYAKLAVYFTNIKDDMFRNGAAIAALFVATLVVGAVVNYVIGQLVQKTGLSGTDRILGMVFGGLRGVLIVSAVLFFMDAFTAFPSSDWWKESQLVPEFKLVIEPFFEHLQATSSFLSGTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.88 | 0.03 | ●●●○○ -2.21 | -2.2087004152290506 | 27185914 |
Retrieved 1 of 1 entries in 71.8 ms
(Link to these results)