Bacterial taxon 223926
Locus VP_1553
Protein BAC59816.1
bacteriophage f237 ORF3
Vibrio parahaemolyticus RIMD 2210633
Length 76 aa, Gene n/a, UniProt Q79YY0
>BAC59816.1|Vibrio parahaemolyticus RIMD 2210633|bacteriophage f237 ORF3
MSVCVTVVNQYGNLKATKTPVADCQEYVLISAVDYQEYKEPVLFNGDLFLYVSGVLLINMVVGHWVGRVVRLMSKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.29 | 0.026 | ○○○○○ 2.28 | 2.2837720447158865 | 27185914 |
Retrieved 1 of 1 entries in 30.4 ms
(Link to these results)