Bacterial taxon 223926
Locus VP_0036
Protein BAC58299.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 83 aa, Gene n/a, UniProt Q87TN3
>BAC58299.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MFDPKKLEQIAKQIHDSMPAPVKELGADVDQKVRQVIQGQLNKLDVVSREEFDVQTQVLLRTRQKLTEMEKKLSELEEKLADK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.47 | 0.0085 | ●●●○○ -2.72 | -2.723992834954758 | 27185914 |
Retrieved 1 of 1 entries in 9.2 ms
(Link to these results)