Bacterial taxon 223926
Locus VP_0146
Protein BAC58409.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 194 aa, Gene nfuA, UniProt Q87TC4
>BAC58409.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MSNITITETAQTHFANLLGQQPEGTNIRIFVVNPGTQNAECGVSYCPPEAVEATDTEIPYAGFSAYVDELSLPFLEDAEIDFVTDKMGSQLTLKAPNAKMRKVSDDAPLVERVEYVIQTQVNPQLAGHGGHVNLVEITEAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLNQFVGELTAVRDATEHDRGDHSYY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.91 | 0.0028 | ●●●●○ -3.11 | -3.105218216979758 | 27185914 |
Retrieved 1 of 1 entries in 106.1 ms
(Link to these results)