Bacterial taxon 223926
Locus VP_0406
Protein BAC58669.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 147 aa, Gene n/a, UniProt Q87SL6
>BAC58669.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MALIDQLKEEQKLAMKAKDKLRLGTIRLALAAIKQREVDEQITLNDDDILAVLTKMVKQRRDSVTQYEAAGRQDLADVEQAEITVLEEFMPQPLTEEEVAALIEKAIAESGAAGMQDMGKVMGVLKPQIQGRADMGKVSGLVRAKLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.56 | 0.007 | ●●●○○ -2.8 | -2.795133831426098 | 27185914 |
Retrieved 1 of 1 entries in 11.1 ms
(Link to these results)