Bacterial taxon 223926
Locus VP_2167
Protein BAC60430.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 94 aa, Gene n/a, UniProt Q87MR4
>BAC60430.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MIHLTATFHAQPGKEQQLKEVLTQALEPTRNEEGCVRYQLFQDKDNASHFVFQEQFKDQEAFEFHGKTVHFARLINQIENLLECEPKLAFFNEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.4 | 0.02 | ○○○○○ 2.38 | 2.3846186349833567 | 27185914 |
Retrieved 1 of 1 entries in 74.6 ms
(Link to these results)