Bacterial taxon 223926
Locus VP_2178
Protein BAC60441.1
conserved hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 109 aa, Gene n/a, UniProt Q87MQ3
>BAC60441.1|Vibrio parahaemolyticus RIMD 2210633|conserved hypothetical protein
MFGKGGMGNLMKQAQQMQERMQKLQEEIANMEVTGESGAGLVKVTITGSHSVRRVDIDESLMEDDKEMLEDLIAAAFNDAARRVEETQKEKMASVTGGMQLPPGMKMPF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.55 | 0.00043 | ●●●●○ -3.66 | -3.6609392849987774 | 27185914 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)