Bacterial taxon 223926
Locus VP_2986
Protein BAC61249.1
CyaY protein
Vibrio parahaemolyticus RIMD 2210633
Length 104 aa, Gene cyaY, UniProt Q87KJ1
>BAC61249.1|Vibrio parahaemolyticus RIMD 2210633|CyaY protein
MNDTEFHQLVDAQMQIIEESIDDSGADIDYEVSGNVMTLEFEDRSQIIINRQEPMHEIWLASKSGGFHFKLVEDKWTCSKTGMELFEMVKQECEKHAGEEIDWA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.91 | 0.029 | ●●●○○ -2.23 | -2.22901143308912 | 27185914 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)