Bacterial taxon 223926
Locus VP_1133
Protein BAC59396.1
DNA-binding protein H-NS
Vibrio parahaemolyticus RIMD 2210633
Length 135 aa, Gene n/a, UniProt Q87QL6
>BAC59396.1|Vibrio parahaemolyticus RIMD 2210633|DNA-binding protein H-NS
MSELTKTLLNIRSLRAFSRELTLEQLEEALDKLTTVVEERREAEEAEREALAQQEAKLAEIAEKIAQDGIDVEALISALSGETKTKAKSKRAPRPAKYKYIDTNGQEKTWTGQGRTPSAIQEQLDAGKSLDDFLI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.89 | 0.03 | ●●●○○ -2.22 | -2.2170198595546333 | 27185914 |
Retrieved 1 of 1 entries in 65.3 ms
(Link to these results)