Bacterial taxon 223926
Locus VP_0229
Protein BAC58492.1
dTDP-4-dehydrorhamnose 3,5-epimerase
Vibrio parahaemolyticus RIMD 2210633
Length 187 aa, Gene n/a, UniProt Q87T41
>BAC58492.1|Vibrio parahaemolyticus RIMD 2210633|dTDP-4-dehydrorhamnose 3,5-epimerase
MKVITTEIEGLLVVEPKVFGDSRGFFLESWNKLKFDEATGMEVSFVQDNHSKSESGTLRGLHIQTKNAQGKLVRVVKGAVYDVAVDLRKDSKTYGKWFGLILSAENKKQLWIPKGFAHGFLALEDDTEFLYKCDGYYDPLYEVSIDWNDKALAIDWGQFESFKTLKLSDKDSKGIGLSEFSTLEKEF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.83 | 0.0035 | ●●●●○ -3.04 | -3.036157798690162 | 27185914 |
Retrieved 1 of 1 entries in 6.7 ms
(Link to these results)