Bacterial taxon 223926
Locus VP_0833
Protein BAC59096.1
ferric uptake regulatory protein
Vibrio parahaemolyticus RIMD 2210633
Length 149 aa, Gene fur, UniProt O24755
>BAC59096.1|Vibrio parahaemolyticus RIMD 2210633|ferric uptake regulatory protein
MSDNNQALKDAGLKVTLPRLKILEVLQQPDCQHISAEDLYKKLIDLGEEIGLATVYRVLNQFDDAGIVTRHHFEGGKSVFELSTQHHHDHLVCLDCGEVIEFSDDIIEERQREIAAKYNVTLTNHSLYLYGKCSDGGCKENPDAHKPAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.15 | 0.018 | ●●●○○ -2.44 | -2.439522012875611 | 27185914 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)