Bacterial taxon 223926
Locus VPA_1523
Protein BAC62866.1
glyoxylase I family protein
Vibrio parahaemolyticus RIMD 2210633
Length 127 aa, Gene n/a, UniProt Q87FZ7
>BAC62866.1|Vibrio parahaemolyticus RIMD 2210633|glyoxylase I family protein
MFNAIHHVAIICSDYPTSKRFYTEVLGLRIIAENYREMRDSYKLDLALPDGSQIELFSFPGSPERPSFPEAQGLRHLAFQVDNVEEVKAYLESKHIAVEPIRIDEFTGKAFTFFQDPDGLPLELYQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.42 | 0.0011 | ○○○○○ 3.49 | 3.489593411876418 | 27185914 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)