Bacterial taxon 223926
Locus VP_0708
Protein BAC58971.1
histidinol phosphatase-related protein
Vibrio parahaemolyticus RIMD 2210633
Length 183 aa, Gene n/a, UniProt Q87RR9
>BAC58971.1|Vibrio parahaemolyticus RIMD 2210633|histidinol phosphatase-related protein
MAKPAVFIDRDGVINVDHGYVHDEHDFEYIDGVFEATKALKDKGYLLVLVTNQSGIARGKFSEDRFLSLTQWMDWNFVDNGVEFDGFYYCPHHPEHGIGDYKQDCDCRKPKPGMFISARDFLKIDMEKSVMIGDKAEDMMAAEAAGVGTKILVRTGKPITEQGEALATVVLDSIADVPAYLQK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.1 | 0.0017 | ●●●●○ -3.27 | -3.267338945997502 | 27185914 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)