Bacterial taxon 223926
Locus VP_1052
Protein BAC59315.1
holliday junction DNA helicase RuvB
Vibrio parahaemolyticus RIMD 2210633
Length 334 aa, Gene ruvB, UniProt Q87QU7
>BAC59315.1|Vibrio parahaemolyticus RIMD 2210633|holliday junction DNA helicase RuvB
MIEADRLIAPENPAFRDEDVIDRAIRPKKLADYQGQDHVRDQMEIFIKAAQLRSEALDHLLIFGPPGLGKTTLANIVANEMEVNIRTTSGPVLEKAGDLAALLTNLEENDVLFIDEIHRLSPMVEEVLYPAMEDYQLDIMIGEGPAARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGITQRLEYYKVQDLQNIVQRSADCLGLSMEPEGALEVARRARGTPRIANRLLRRVRDYAEVKGNGHICADVADKALNMLDVDAQGFDYMDRKLLLAIMEKFGGGPVGLDNMAAAIGEEKDTIEDVLEPYLIQQGYLQRTPRGRIATDRAYLHFGIEK
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.44 | 0.00061 | ●●●●○ -3.56 | -3.5614042380119084 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)