Bacterial taxon 223926
Locus VPA_0597
Protein BAC61940.1
hypotheteical protein
Vibrio parahaemolyticus RIMD 2210633
Length 57 aa, Gene n/a, UniProt Q87IK9
>BAC61940.1|Vibrio parahaemolyticus RIMD 2210633|hypotheteical protein
MVTQNTNFSPEQPKHEKDEQQNVAIVEFNSSVLSRQSTDFLTHEELKMLEAVIGIAF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.51 | 0.029 | ○○○○○ 2.38 | 2.3782908228401958 | 27185914 |
Retrieved 1 of 1 entries in 39 ms
(Link to these results)