Bacterial taxon 223926
Locus VPA_0010
Protein BAC61353.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 69 aa, Gene n/a, UniProt Q87K88
>BAC61353.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MSFNLSLLPPDEKNKIELDKQASFLVWKLREAKSGPEAIEEQLSKINDADEKVFFQRAVEKYKRVMGVA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.21 | 0.0026 | ○○○○○ 3.24 | 3.235216219667477 | 27185914 |
Retrieved 1 of 1 entries in 18.9 ms
(Link to these results)