Bacterial taxon 223926
Locus VPA_0058
Protein BAC61401.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 93 aa, Gene n/a, UniProt Q87K40
>BAC61401.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MAVQRKHSDLPPRYEASDLTNEQRHRFTEVANAAHKRRKFYKQAIEKSLVGKMKERAFKPVIAPQQGKPSRARQAFWLIVFLALGLWAMHFFA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.7 | 0.016 | ○○○○○ 2.61 | 2.6140579481101227 | 27185914 |
Retrieved 1 of 1 entries in 25.6 ms
(Link to these results)