Bacterial taxon 223926
Locus VPA_0206
Protein BAC61549.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 50 aa, Gene n/a, UniProt Q87JP2
>BAC61549.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MMKGFKSHLPTKLCPVCERPFSWRKKWARNWETVIYCSERCRRSKPEKKP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.17 | 0.0031 | ○○○○○ 3.18 | 3.1837290304110977 | 27185914 |
Retrieved 1 of 1 entries in 13.8 ms
(Link to these results)