Bacterial taxon 223926
Locus VPA_0598
Protein BAC61941.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 32 aa, Gene n/a, UniProt Q87IK8
>BAC61941.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MIPPYFSTDFIDKKAVVHQRLSFHFHCFNTTD
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 3.3 | 1.4e-5 | ○○○○○ 4.58 | 4.577522764627211 | 27185914 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)