Bacterial taxon 223926
Locus VPA_0605
Protein BAC61948.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 132 aa, Gene n/a, UniProt Q87IK1
>BAC61948.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MALGCILKTTYQENVMSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVELHHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEDIRWIPYKKLPHSHTLEDLLAELESDPQACFWE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.14 | 0.0035 | ○○○○○ 3.15 | 3.146939442458766 | 27185914 |
Retrieved 1 of 1 entries in 51.6 ms
(Link to these results)