Bacterial taxon 223926
Locus VPA_0610
Protein BAC61953.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 41 aa, Gene n/a, UniProt Q87IJ6
>BAC61953.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MRFRAAYFLFAPLLFNNFLIFQQSFSESDLIEQILLIYSKF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 4.09 | 1.1e-7 | ○○○○○ 5.54 | 5.5373785674541685 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)