Bacterial taxon 223926
Locus VPA_0696
Protein BAC62039.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 51 aa, Gene n/a, UniProt Q87IB0
>BAC62039.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLFEAHSIDEPRPKNSPRFGEFFYLHAKFFYFFTITSRFITQNALLLTKLI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.29 | 0.036 | ●●●○○ -2.28 | -2.2820433775678386 | 27185914 |
Retrieved 1 of 1 entries in 42.9 ms
(Link to these results)