Bacterial taxon 223926
Locus VPA_0702
Protein BAC62045.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 37 aa, Gene n/a, UniProt Q87IA4
>BAC62045.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MKTHFALHFAYLDRNIKHIFYSLSSLLTTQSAHFTYS
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.58 | 0.00027 | ●●●●○ -3.87 | -3.8742823822995094 | 27185914 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)