Bacterial taxon 223926
Locus VPA_0905
Protein BAC62248.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 103 aa, Gene n/a, UniProt Q87HQ5
>BAC62248.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MEMLSLKECQQAMAALDAADKLNASVENELSQFKNMDTNAIIKRASKMLMTGNLSLEAFGLNPTLFQQIEQLTKLNNKVRAKYRGCVQDNIQQLESVEATADE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.47 | 0.033 | ○○○○○ 2.33 | 2.326253916531299 | 27185914 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)