Bacterial taxon 223926
Locus VPA_0956
Protein BAC62299.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 30 aa, Gene n/a, UniProt Q87HK7
>BAC62299.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MKTTNTFKWEEDKPINNTEGFKQSPFFTTI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.47 | 0.021 | ●●●○○ -2.5 | -2.501573247419221 | 27185914 |
Retrieved 1 of 1 entries in 16.4 ms
(Link to these results)