Bacterial taxon 223926
Locus VPA_1179
Protein BAC62522.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 50 aa, Gene n/a, UniProt Q87GY6
>BAC62522.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MFSINLNATFAHCNNIFSVQFFAISNNAQALSNKGKRLFGLTAKHTVKKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.57 | 0.024 | ○○○○○ 2.46 | 2.455524030730822 | 27185914 |
Retrieved 1 of 1 entries in 60.6 ms
(Link to these results)