Bacterial taxon 223926
Locus VPA_1291
Protein BAC62634.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 36 aa, Gene n/a, UniProt Q87GM4
>BAC62634.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLHHYKPTLVCAEKQSKFEHPLDIYQTLKTYRTLIF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.72 | 0.015 | ○○○○○ 2.64 | 2.6395314852202016 | 27185914 |
Retrieved 1 of 1 entries in 19.8 ms
(Link to these results)