Bacterial taxon 223926
Locus VPA_1333
Protein BAC62676.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 161 aa, Gene n/a, UniProt Q87GI3
>BAC62676.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MKLNIKRLHLSLTLMSVVMLLVIIYNNFFQPVHFYETSYKYQAADSTYMHDVAINVSIKGNHFTSDIIIRELVKSENKNYYNVIGHGDIIQKNTHQYYLNFDNIDVYTGTNKANMKPYKEPTSISSLINKSNNIRVVYLSEEYVVVEFFFYDGQIITLHRY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.79 | 0.0001 | ●●●●● -4.12 | -4.1204915390877614 | 27185914 |
Retrieved 1 of 1 entries in 47 ms
(Link to these results)