Bacterial taxon 223926
Locus VPA_1351
Protein BAC62694.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 336 aa, Gene n/a, UniProt Q87GG5
>BAC62694.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MRAMWLLEFFSGCVKGVTLPIENKLVLVGREDAKEDNIIPLAEFLTPEERIELEEQSGKVQAVGLSKKKVTLVENKIYRYRGLTFCVYRQGKGNPSLKYFRLRQFQPLLIVTVAVHLLLAVGGFSLNDAIQKQQFGDYLQAIGNGYIKDGQLYTSKYSELSRLPEQWGNFIQSLNEENYLQATQFNLELVSAYSGKPLQGEITSLPNRDQIRVETFELDNQVMATLGKHAISFYKQGANWFVSDPARAKQVLTDAGLSQTVSSLKSRADGADLISDAEFPYSIFYTSHSGRYLYDELGRYWEGSEVPELGVIQEIREDRVVFFDGKQTRAYLIQVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.8 | 9.3e-5 | ●●●●● -4.14 | -4.1397379148798645 | 27185914 |
Retrieved 1 of 1 entries in 8.8 ms
(Link to these results)