Bacterial taxon 223926
Locus VPA_1356
Protein BAC62699.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 203 aa, Gene n/a, UniProt Q87GG0
>BAC62699.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MVRCTLYIELDASQKAIPKVGFVRPRHSNLIKRSELATYQNSKVLIMALEEKVKEYQNLLEEQVLMMLEEKEQLLNQVIVDEYQKVSEAWKEQQIEWFKVAEHELSRHLKEQEEAILDVKRELKHQIALEVQARLTKLTQSEKLISHLVEVLHSEMDDACKVLQVETEQHEDGVTLSIEDDDRVISIDSKTIIEELKRGLDSI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.35 | 4.5e-6 | ●●●●● -4.82 | -4.815721294421559 | 27185914 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)