Bacterial taxon 223926
Locus VPA_1359
Protein BAC62702.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 135 aa, Gene n/a, UniProt Q87GF7
>BAC62702.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MVHTTMKHFNLKQTTLDPYQILKSKSNRISWNGFSDSQQYIDKAAVIEWFGLLRDYSEEIVKAIIVDGILENEFHKITFILNLVQSKEFQSMSSMQVYQLLYDFVCKTPQGILAWIDEKDFLMSRDVLAILSRNR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.48 | 0.00044 | ●●●●○ -3.75 | -3.7487932612237254 | 27185914 |
Retrieved 1 of 1 entries in 46.5 ms
(Link to these results)