Bacterial taxon 223926
Locus VPA_1372
Protein BAC62715.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 36 aa, Gene n/a, UniProt Q87GE4
Protein visualisation (by ProViz)
>BAC62715.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MHQNILDFQQNPHVSHAGLVIKTINFQRYFCRSLHL
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -2.62 | 0.013 | ●●●○○ -2.69 | -2.6859268347327605 | 27185914 |
Retrieved 1 of 1 entries in 17.9 ms
(Link to these results)