Bacterial taxon 223926
Locus VPA_1692
Protein BAC63035.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 52 aa, Gene n/a, UniProt Q87FI7
>BAC63035.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MQQGFKKFMLNQLDKQCTMTFIYLFIFVTFFMWVFIKRAKVAPINVNVVNTE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.9 | 0.0083 | ○○○○○ 2.86 | 2.8554079646950012 | 27185914 |
Retrieved 1 of 1 entries in 26.3 ms
(Link to these results)