Bacterial taxon 223926
Locus VP_0009
Protein BAC58272.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 49 aa, Gene n/a, UniProt Q87TQ9
>BAC58272.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MEKRSNQSERIEKRGAGKKIIHRVITNLSISLNLPKCGSMCGQIWGKVC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.09 | 0.037 | ○○○○○ 2.12 | 2.117092013850332 | 27185914 |
Retrieved 1 of 1 entries in 22.4 ms
(Link to these results)