Bacterial taxon 223926
Locus VP_0321
Protein BAC58584.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 49 aa, Gene n/a, UniProt Q87SV1
>BAC58584.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MVFCLIEYAGCSTLNQHALFICQFFLELRTQYPRKHFNAANKALGTLAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.05 | 0.04 | ○○○○○ 2.08 | 2.081602380213323 | 27185914 |
Retrieved 1 of 1 entries in 2.4 ms
(Link to these results)