Bacterial taxon 223926
Locus VP_0403
Protein BAC58666.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 111 aa, Gene n/a, UniProt Q87SL9
>BAC58666.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MKKGKMVKAQPMPDLNTEFSMETLGSAIRSKRTDRGWRIDDLASKANLSRRTVMKVEKGDTSVTFANVLVLMDILGLSLRLIDLNLFVRPHSQITSQAENSVRSSEDGWYE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.14 | 0.018 | ●●●○○ -2.43 | -2.434558867344785 | 27185914 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)