Bacterial taxon 223926
Locus VP_1445
Protein BAC59708.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 115 aa, Gene n/a, UniProt Q87PQ6
>BAC59708.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MKASELISILNNLPSNSNPDIVMGEEWLPERLVDTKLDGELLFLHFDNAPEDGQGDEEGRGFVDHEIDLIRTRLQQILDEDSDNASKADAMLGLFLMGHELSSSQVIEVLEESDT
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 1.93 | 0.049 | ○○○○○ 1.98 | 1.9761596180525294 | 27185914 |
Retrieved 1 of 1 entries in 32.6 ms
(Link to these results)