Bacterial taxon 223926
Locus VP_1684
Protein BAC59947.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 166 aa, Gene n/a, UniProt Q87P34
>BAC59947.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLCAYFNKPSSNLTGHNMDTGKINILLAELGDSLNLERVTEFEHQMWSLCFSEDNAIDVQFVQEKNEVLVSKSLVVEKDILTADKLQVLLEYNFLYRETGGVQFCINPTTKDILLQIAITADTEISQLANVISQLNELSDTWVQLFQNNTVVDFSQQTGSHPFIQV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.42 | 0.019 | ○○○○○ 2.4 | 2.4014910529772617 | 27185914 |
Retrieved 1 of 1 entries in 29.3 ms
(Link to these results)