Bacterial taxon 223926
Locus VP_1698
Protein BAC59961.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 332 aa, Gene n/a, UniProt Q87P20
>BAC59961.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MRRRTQMKKQHWRRRSLFPDSIVTQRKVTVLQRGARYESASQPLQDLNVVHVNHRQLLSEGVLNDDQLSLLQRLLDRSVVDSLCASQLVKTYLRLGTSIDRFAMRLFLEIGAQLSDSQRVATFEQRLEYINSRLGFRFNLATPKTLILCCYLALTEWIHRQTDQSALHASVKVEQLMNQLDIQKEYWSKLSGEDTSAIFVEQQLALIESQQTQLKAQLNTLNEQQSQVIESHKALVDKWQPSLSNLKELADYTSTTDMFISDWKTWCSEARLQAPDLNEVWDACDVVYNDLNAVAKVWQWFKDMQIVGDVDHYYFDIQSGQCGQACNHLSQI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.65 | 0.00031 | ●●●●○ -3.75 | -3.7469219865417087 | 27185914 |
Retrieved 1 of 1 entries in 41.6 ms
(Link to these results)