Bacterial taxon 223926
Locus VP_1769
Protein BAC60032.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 50 aa, Gene n/a, UniProt Q87NU9
>BAC60032.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MTFIIYAMAYRKRETVFFCSFAWNLNFQLCLAKNEKTTFNGGFLIIFSVA
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.85 | 0.0073 | ○○○○○ 2.78 | 2.777892582945692 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)