Bacterial taxon 223926
Locus VP_1811
Protein BAC60074.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 49 aa, Gene n/a, UniProt Q87NQ7
>BAC60074.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MNNSDKETLVLPKISQRQRNNTKEIVRKLETVNDELKTKTSHLVPPERT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.56 | 0.0069 | ●●●○○ -2.8 | -2.800087550228696 | 27185914 |
Retrieved 1 of 1 entries in 41.2 ms
(Link to these results)