Bacterial taxon 223926
Locus VP_1838
Protein BAC60101.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 30 aa, Gene n/a, UniProt Q87NN0
>BAC60101.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MIRNAWHFYFALALVFKVVCGGCGIALLTP
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.38 | 0.021 | ○○○○○ 2.36 | 2.3639612424873424 | 27185914 |
Retrieved 1 of 1 entries in 2.6 ms
(Link to these results)