Bacterial taxon 223926
Locus VP_1885
Protein BAC60148.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 42 aa, Gene n/a, UniProt Q87NI3
>BAC60148.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MTEIIYTDTFGNTADERIDYLSQWTPTPQVVEKVETLIETFE
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 4.06 | 0.00023 | ○○○○○ 3.83 | 3.828839487726886 | 27185914 |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)