Bacterial taxon 223926
Locus VP_2211
Protein BAC60474.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 242 aa, Gene n/a, UniProt Q87MM0
>BAC60474.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MDDLEFRRRILSDPKQKDEEILQALAASDANSKFVDDVLDLDAKIKQAMNVDVPEDLADKILFSQTSSALDEKVVKPNFVRKAMALAASVAFTAGLLVGQINWGNILVPPAQASLADTAIKHVIHEESFVRHLDENVPSSQINAKMSPFHYQFSDNFPYHVYYLNHCGFGEANALHMVFQGVKGKVTLFITGISSQQSADFEKDGMTGIVQPVGSTSMILVGEQGEDIDAIATKLAPMLKPM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.91 | 0.00013 | ●●●●○ -3.97 | -3.9740767915047286 | 27185914 |
Retrieved 1 of 1 entries in 113.8 ms
(Link to these results)