Bacterial taxon 223926
Locus VP_2651
Protein BAC60914.1
hypothetical protein
Vibrio parahaemolyticus RIMD 2210633
Length 45 aa, Gene n/a, UniProt Q87LG1
>BAC60914.1|Vibrio parahaemolyticus RIMD 2210633|hypothetical protein
MLTFCFFVMGFNIWAGRIIAVWRLFVAFHRNPCHISPDQHTQYRV
Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.11 | 0.036 | ○○○○○ 2.14 | 2.135230188541843 | 27185914 |
Retrieved 1 of 1 entries in 31.2 ms
(Link to these results)