Bacterial taxon 223926
Locus VP_0717
Protein BAC58980.1
lipoate-protein ligase B
Vibrio parahaemolyticus RIMD 2210633
Length 220 aa, Gene lipB, UniProt Q87RR0
>BAC58980.1|Vibrio parahaemolyticus RIMD 2210633|lipoate-protein ligase B
MQHQLVVKRLGRQDYEPVWKAMHEFTDQRTEETPDEVWLVEHNPVFTQGQAGKAEHLINTGDIPVVQSDRGGQVTYHGPGQLVAYFLINLRRKKLGVRDLVTTIENLVINTLKAYNIDSAARPDAPGVYVDGKKICSLGLRIRKGCSFHGLALNVNMDLTPFLRINPCGYAGMEMVQVSQFNGPSDVETVEKQLIEELVTLLDYERVEFSTEAPSQGNKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -3.2 | 0.016 | ●●●○○ -2.49 | -2.4850494458724466 | 27185914 |
Retrieved 1 of 1 entries in 83 ms
(Link to these results)