Bacterial taxon 223926
Locus VP_1658
Protein BAC59921.1
low calcium response locus protein H
Vibrio parahaemolyticus RIMD 2210633
Length 162 aa, Gene n/a, UniProt Q87P60
>BAC59921.1|Vibrio parahaemolyticus RIMD 2210633|low calcium response locus protein H
MTKTNATDPSQMQAEELLSFLEEGGTLKMLHDVSADTIEHIYAVGYNFFQSGKIEQAAKVFQLLSMLDHYQARFFIGLGAARQELGEYLQAIDAYSYAALVDINDPRPPFHSAECHLKLEQLTEAESGFYSAKEMSAGKSQYADLHQRAGIMLEAVRNKRSN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 3.66 | 0.00081 | ○○○○○ 3.48 | 3.4802211233837963 | 27185914 |
Retrieved 1 of 1 entries in 60.5 ms
(Link to these results)