Bacterial taxon 223926
Locus VP_1160
Protein BAC59423.1
NapE protein
Vibrio parahaemolyticus RIMD 2210633
Length 59 aa, Gene n/a, UniProt Q87QI9
>BAC59423.1|Vibrio parahaemolyticus RIMD 2210633|NapE protein
MSDVNKIESGEKRSLEWKSFLFIAVVLFPILSVAFVGGYGFIVWALQVFFFGPPGAHGM
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | 2.53 | 0.015 | ○○○○○ 2.49 | 2.493647225882728 | 27185914 |
Retrieved 1 of 1 entries in 70.1 ms
(Link to these results)