Bacterial taxon 223926
Locus VP_1061
Protein BAC59324.1
peptidoglycan-associated lipoprotein
Vibrio parahaemolyticus RIMD 2210633
Length 174 aa, Gene pal, UniProt Q87QT8
>BAC59324.1|Vibrio parahaemolyticus RIMD 2210633|peptidoglycan-associated lipoprotein
MQLNKVLKGLLIALPVMAMTACSSSDDAASNTGAATNNNAAAETTVATPIDQSGQLTEQELKEQALRETQTIYFAFDNSTIAGDYEEMLAAHASYLSKNPALKVTIEGHADERGTPEYNIALGERRAQAVANYLQALGVQADQISIVSYGEEKPLLLGQSDEVYAKNRRAVLVY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Rabbit (Oryctolagus cuniculus) | small intestine | BTO:0000651 | 24 h | not available in this study | -4.4 | 0.00069 | ●●●●○ -3.53 | -3.5273067188399425 | 27185914 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)